Crystal structure of thioredoxin from escherichia coli at 1.68 angstroms resolution
PDB DOI: 10.2210/pdb2trx/pdb
Classification: ELECTRON TRANSPORT Organism(s): Escherichia Coli
Deposited: 1990-03-19 Deposition Author(s): Eklund, H. , Katti, S.K. , Lemaster, D.M.
Crystal structure of thioredoxin from escherichia coli at 1.68 angstroms resolution
Eklund, H. , Katti, S.K. , Lemaster, D.M.
Primary Citation of Related Structures: 2TRX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| THIOREDOXIN | A | 108 | Escherichia Coli | SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA |
| THIOREDOXIN | B | 108 | Escherichia Coli | SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA |
Method: X-RAY DIFFRACTION
Deposited Date: 1990-03-19 Deposition Author(s): Eklund, H. , Katti, S.K. , Lemaster, D.M.