The refined structure of sindbis virus core protein in comparison with other chymotrypsin-like serine proteinase structures
PDB DOI: 10.2210/pdb2snv/pdb
Classification: VIRAL PROTEIN Organism(s): Sindbis Virus
Deposited: 1992-07-17 Deposition Author(s): Rossmann, M.G. , Tong, L.
The refined structure of sindbis virus core protein in comparison with other chymotrypsin-like serine proteinase structures
Primary Citation of Related Structures: 2SNV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SINDBIS VIRUS COAT PROTEIN | A | 151 | Sindbis Virus | RLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW |
Method: X-RAY DIFFRACTION
Deposited Date: 1992-07-17 Deposition Author(s): Rossmann, M.G. , Tong, L.