Solution structure of the chromodomain of hp1a with the phosphorylated n-terminal tail complexed with h3k9me3 peptide
PDB DOI: 10.2210/pdb2rvn/pdb
Classification: TRANSCRIPTION/PEPTIDE Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-12-18 Deposition Author(s): Kawaguchi, A. , Nishimura, Y.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the chromodomain of hp1a with the phosphorylated n-terminal tail complexed with h3k9me3 peptide
Primary Citation of Related Structures: 2RVN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chromobox protein homolog 5 | A | 83 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK |
18-mer peptide of Histone H3 | B | 18 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTGGKAPRY |
Method: SOLUTION NMR
Deposited Date: 2015-12-18 Deposition Author(s): Kawaguchi, A. , Nishimura, Y.