Nmr structure of epithelial splicing regulatory protein 1
PDB DOI: 10.2210/pdb2rvj/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2015-10-23 Deposition Author(s): Allemand, F. , Guichou, J. , Labesse, G. , Yang, Y.
Nmr structure of epithelial splicing regulatory protein 1
Allemand, F. , Guichou, J. , Labesse, G. , Yang, Y.
Primary Citation of Related Structures: 2RVJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Epithelial splicing regulatory protein 1 | A | 104 | Homo Sapiens | MPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRLE |
Method: SOLUTION NMR
Deposited Date: 2015-10-23 Deposition Author(s): Allemand, F. , Guichou, J. , Labesse, G. , Yang, Y.