Solution structures of the dna-binding domain (zf8) of mouse immune-related zinc-finger protein zfat
PDB DOI: 10.2210/pdb2rv5/pdb
Classification: TRANSCRIPTION Organism(s): Mus Musculus
Deposited: 2015-01-26 Deposition Author(s): Kigawa, T. , Tochio, N. , Umehara, T. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structures of the dna-binding domain (zf8) of mouse immune-related zinc-finger protein zfat
Kigawa, T. , Tochio, N. , Umehara, T. , Yokoyama, S.
Primary Citation of Related Structures: 2RV5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger protein ZFAT | A | 35 | Mus Musculus | GSSGSSGYVCALCLKKFVSSIRLRSHIREVHGAAQ |
Method: SOLUTION NMR
Deposited Date: 2015-01-26 Deposition Author(s): Kigawa, T. , Tochio, N. , Umehara, T. , Yokoyama, S.