Solution structure of c.elegans sup-12 rrm in complex with rna
PDB DOI: 10.2210/pdb2ru3/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-11-12 Deposition Author(s): Guntert, P. , Hagiwara, M. , He, F. , Ito, T. , Kobayashi, N. , Kuroyanagi, H. , Kuwasako, K. , Muto, Y. , Shirouzu, M. , Takahashi, M. , Tanaka, A. , Tsuda, K. , Unzai, S. , Yokoyama, S. , Yoshikawa, S.
Solution structure of c.elegans sup-12 rrm in complex with rna
Guntert, P. , Hagiwara, M. , He, F. , Ito, T. , Kobayashi, N. , Kuroyanagi, H. , Kuwasako, K. , Muto, Y. , Shirouzu, M. , Takahashi, M. , Tanaka, A. , Tsuda, K. , Unzai, S. , Yokoyama, S. , Yoshikawa, S.
Primary Citation of Related Structures: 2RU3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein SUP-12, isoform a | A | 103 | Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQ |
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA (5'-R(*GP*UP*GP*UP*GP*C)-3') | b | 6 | NA | GUGUGC |
Method: SOLUTION NMR
Deposited Date: 2013-11-12 Deposition Author(s): Guntert, P. , Hagiwara, M. , He, F. , Ito, T. , Kobayashi, N. , Kuroyanagi, H. , Kuwasako, K. , Muto, Y. , Shirouzu, M. , Takahashi, M. , Tanaka, A. , Tsuda, K. , Unzai, S. , Yokoyama, S. , Yoshikawa, S.