Solution structure of the chromodomain of chp1 in complex with h3k9me3 peptide
PDB DOI: 10.2210/pdb2rsn/pdb
Classification: NUCLEAR PROTEIN Organism(s): Schizosaccharomyces Pombe , Synthetic Construct
Deposited: 2012-04-18 Deposition Author(s): Nishimura, Y. , Shimojo, H.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the chromodomain of chp1 in complex with h3k9me3 peptide
Primary Citation of Related Structures: 2RSN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromo domain-containing protein 1 | A | 75 | Schizosaccharomyces Pombe , Synthetic Construct | MVSVKPLPDIDSNEGETDADVYEVEDILADRVNKNGINEYYIKWAGYDWYDNTWEPEQNLFGAEKVLKKWKKRKK |
| peptide from Histone H3 | B | 18 | Schizosaccharomyces Pombe , Synthetic Construct | ARTKQTARKSTGGKAPRY |
Method: SOLUTION NMR
Deposited Date: 2012-04-18 Deposition Author(s): Nishimura, Y. , Shimojo, H.