Solution structure of the bromodomain of human brpf1 in complex with histone h4k5ac peptide
PDB DOI: 10.2210/pdb2rs9/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2011-12-08 Deposition Author(s): Hayashi, F. , Nagashima, T. , Qin, X. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Umehara, T. , Yokoyama, S.
Solution structure of the bromodomain of human brpf1 in complex with histone h4k5ac peptide
Hayashi, F. , Nagashima, T. , Qin, X. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Umehara, T. , Yokoyama, S.
Primary Citation of Related Structures: 2RS9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Acetylated lysine 5 of peptide from Histone H4 | A | 10 | Homo Sapiens , Synthetic Construct | SGRGKGGKGL |
| Peregrin | B | 121 | Homo Sapiens , Synthetic Construct | GSSGSSGFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2011-12-08 Deposition Author(s): Hayashi, F. , Nagashima, T. , Qin, X. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Umehara, T. , Yokoyama, S.