2RRA
Solution structure of rna binding domain in human tra2 beta protein in complex with rna (gaagaa)
PDB DOI: 10.2210/pdb2rra/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2010-06-17 Deposition Author(s): Inoue, M. , Kigawa, T. , Kuwasako, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Someya, T. , Sugano, S. , Takahashi, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of rna binding domain in human tra2 beta protein in complex with rna (gaagaa)
Inoue, M. , Kigawa, T. , Kuwasako, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Someya, T. , Sugano, S. , Takahashi, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Primary Citation of Related Structures: 2RRA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cDNA FLJ40872 fis, clone TUTER2000283, highly similar to Homo sapiens transformer-2-beta (SFRS10) gene | A | 99 | Homo Sapiens , Synthetic Construct | GSSGSSGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-R(*GP*AP*AP*GP*AP*A)-3' | b | 6 | NA | GAAGAA |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-06-17 Deposition Author(s): Inoue, M. , Kigawa, T. , Kuwasako, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Someya, T. , Sugano, S. , Takahashi, M. , Terada, T. , Tsuda, K. , Yokoyama, S.