Solution structure of the human ddef1 sh3 domain
PDB DOI: 10.2210/pdb2rqt/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2009-12-14 Deposition Author(s): Ikegami, T. , Kaieda, S. , Matsui, C. , Mimori-Kiyosue, Y.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the human ddef1 sh3 domain
Ikegami, T. , Kaieda, S. , Matsui, C. , Mimori-Kiyosue, Y.
Primary Citation of Related Structures: 2RQT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 | A | 61 | Homo Sapiens | VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD |
Method: SOLUTION NMR
Deposited Date: 2009-12-14 Deposition Author(s): Ikegami, T. , Kaieda, S. , Matsui, C. , Mimori-Kiyosue, Y.