Nmr solution structure of mesoderm development (mesd) - open conformation
PDB DOI: 10.2210/pdb2rqm/pdb
Classification: CHAPERONE Organism(s): Mus Musculus
Deposited: 2009-08-14 Deposition Author(s): Andersen, O.M. , Diehl, A. , Holdener, B.C. , Koehler, C. , Lighthouse, J.K. , Oschkinat, H. , Schmieder, P. , Werther, T.
Nmr solution structure of mesoderm development (mesd) - open conformation
Andersen, O.M. , Diehl, A. , Holdener, B.C. , Koehler, C. , Lighthouse, J.K. , Oschkinat, H. , Schmieder, P. , Werther, T.
Primary Citation of Related Structures: 2RQM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mesoderm development candidate 2 | A | 141 | Mus Musculus | GDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGK |
Method: SOLUTION NMR
Deposited Date: 2009-08-14 Deposition Author(s): Andersen, O.M. , Diehl, A. , Holdener, B.C. , Koehler, C. , Lighthouse, J.K. , Oschkinat, H. , Schmieder, P. , Werther, T.