2RQC
Solution structure of rna-binding domain 3 of cugbp1 in complex with rna (ug)3
PDB DOI: 10.2210/pdb2rqc/pdb
Classification: TRANSCRIPTION/RNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-04-09 Deposition Author(s): Inoue, M. , Kigawa, T. , Kuwasako, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Someya, T. , Takahashi, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of rna-binding domain 3 of cugbp1 in complex with rna (ug)3
Inoue, M. , Kigawa, T. , Kuwasako, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Someya, T. , Takahashi, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Primary Citation of Related Structures: 2RQC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CUG-BP- and ETR-3-like factor 1 | A | 115 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSSGSSGLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKSGPSSG |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-R(*UP*GP*UP*GP*UP*G)-3' | b | 6 | NA | UGUGUG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-04-09 Deposition Author(s): Inoue, M. , Kigawa, T. , Kuwasako, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Someya, T. , Takahashi, M. , Terada, T. , Tsuda, K. , Yokoyama, S.