Solution structure of fn14 crd domain
PDB DOI: 10.2210/pdb2rpj/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2008-05-19 Deposition Author(s): Dang, W. , He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of fn14 crd domain
Dang, W. , He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2RPJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tumor necrosis factor receptor superfamily member 12A | A | 50 | Homo Sapiens | GSSGSSGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAA |
Method: SOLUTION NMR
Deposited Date: 2008-05-19 Deposition Author(s): Dang, W. , He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.