Solution structure of thermus thermophilus hb8 ttha1718 protein in vitro
PDB DOI: 10.2210/pdb2roe/pdb
Classification: METAL BINDING PROTEIN Organism(s): Thermus Thermophilus
Deposited: 2008-03-20 Deposition Author(s): Guentert, P. , Hamatsu, J. , Ikeya, T. , Ito, Y. , Koyama, H. , Mikawa, T. , Mishima, M. , Sakakibara, D. , Sasaki, A. , Shirakawa, M. , Smith, B.O. , Waelchli, M.
Solution structure of thermus thermophilus hb8 ttha1718 protein in vitro
Guentert, P. , Hamatsu, J. , Ikeya, T. , Ito, Y. , Koyama, H. , Mikawa, T. , Mishima, M. , Sakakibara, D. , Sasaki, A. , Shirakawa, M. , Smith, B.O. , Waelchli, M.
Primary Citation of Related Structures: 2ROE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Heavy metal binding protein | A | 66 | Thermus Thermophilus | MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA |
Method: SOLUTION NMR
Deposited Date: 2008-03-20 Deposition Author(s): Guentert, P. , Hamatsu, J. , Ikeya, T. , Ito, Y. , Koyama, H. , Mikawa, T. , Mishima, M. , Sakakibara, D. , Sasaki, A. , Shirakawa, M. , Smith, B.O. , Waelchli, M.