2RND
Structure of the n-terminal barpeptide in dpc micelles
PDB DOI: 10.2210/pdb2rnd/pdb
Classification: ENDOCYTOSIS Organism(s): Homo Sapiens
Deposited: 2007-12-16 Deposition Author(s): Balbach, J. , Loew, C. , Weininger, U.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the n-terminal barpeptide in dpc micelles
Balbach, J. , Loew, C. , Weininger, U.
Primary Citation of Related Structures: 2RND
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myc box-dependent-interacting protein 1 | A | 34 | Homo Sapiens | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-12-16 Deposition Author(s): Balbach, J. , Loew, C. , Weininger, U.