Structure of the n-terminal barpeptide in sds micelles
PDB DOI: 10.2210/pdb2rmy/pdb
Classification: ENDOCYTOSIS Organism(s): Salmonella Enterica
Deposited: 2007-12-03 Deposition Author(s): Balbach, J. , Loew, C. , Weininger, U.
Method: SOLUTION NMR Resolution: N.A.
Structure of the n-terminal barpeptide in sds micelles
Balbach, J. , Loew, C. , Weininger, U.
Primary Citation of Related Structures: 2RMY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Myc box-dependent-interacting protein 1 | A | 34 | Salmonella Enterica | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLY |
Method: SOLUTION NMR
Deposited Date: 2007-12-03 Deposition Author(s): Balbach, J. , Loew, C. , Weininger, U.