Proton channel m2 from influenza a in complex with inhibitor rimantadine
PDB DOI: 10.2210/pdb2rlf/pdb
Classification: PROTON TRANSPORT
Organism(s): Influenza A Virus (A/Udorn/307/1972(H3N2))
Deposited: 2007-07-11
Deposition Author(s): Chou, J.J. , Schnell, J.R.
Proton channel m2 from influenza a in complex with inhibitor rimantadine
Primary Citation of Related Structures: 2RLF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Matrix protein 2 | A | 43 | Influenza A Virus (A/Udorn/307/1972(H3N2)) | RSNDSSDPLVVAASIIGILHLILWILDRLFFKSIYRFFEHGLK |
Matrix protein 2 | B | 43 | Influenza A Virus (A/Udorn/307/1972(H3N2)) | RSNDSSDPLVVAASIIGILHLILWILDRLFFKSIYRFFEHGLK |
Matrix protein 2 | C | 43 | Influenza A Virus (A/Udorn/307/1972(H3N2)) | RSNDSSDPLVVAASIIGILHLILWILDRLFFKSIYRFFEHGLK |
Matrix protein 2 | D | 43 | Influenza A Virus (A/Udorn/307/1972(H3N2)) | RSNDSSDPLVVAASIIGILHLILWILDRLFFKSIYRFFEHGLK |
Method: SOLUTION NMR
Deposited Date: 2007-07-11
Deposition Author(s): Chou, J.J. , Schnell, J.R.