PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

2RKY

Crystal structure of the fourth and fifth fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1

PDB DOI: 10.2210/pdb2rky/pdb

Classification: CELL ADHESION
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2007-10-18
Deposition Author(s): Bingham, R.J.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.8 Å

2rky
Literature

Crystal structure of the fourth and fifth fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1

Bingham, R.J.

Primary Citation of Related Structures: 2RKY


Proteins
Molecule Chains Sequence Length Organism Sequence
Fibronectin A 93 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) AEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTS
Fibronectin C 93 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) AEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTS
Fibronectin-binding protein B 23 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) NEKNGPIIQNNKFEYKEDTIKET
Fibronectin-binding protein D 23 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) NEKNGPIIQNNKFEYKEDTIKET
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2007-10-18
Deposition Author(s): Bingham, R.J.