X-ray structure of the protein q7cqi7. northeast structural genomics consortium target str87a
PDB DOI: 10.2210/pdb2rd1/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Salmonella Typhimurium Lt2
Deposited: 2007-09-20 Deposition Author(s): Acton, T.B. , Baran, M.C. , Fang, Y. , Hunt, J.F. , Kuzin, A.P. , Liu, J. , Mao, L.-C. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Owens, L. , Rost, B. , Seetharaman, J. , Su, M. , Tong, L. , Vorobiev, S.M. , Wang, D. , Xiao, R.
Method: X-RAY DIFFRACTION Resolution: 2.3 Å
X-ray structure of the protein q7cqi7. northeast structural genomics consortium target str87a
Acton, T.B. , Baran, M.C. , Fang, Y. , Hunt, J.F. , Kuzin, A.P. , Liu, J. , Mao, L.-C. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Owens, L. , Rost, B. , Seetharaman, J. , Su, M. , Tong, L. , Vorobiev, S.M. , Wang, D. , Xiao, R.
Primary Citation of Related Structures: 2RD1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Putative outer membrane lipoprotein | A | 62 | Salmonella Typhimurium Lt2 | CTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLIKADLEHHHHHH |
Putative outer membrane lipoprotein | B | 62 | Salmonella Typhimurium Lt2 | CTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLIKADLEHHHHHH |
Putative outer membrane lipoprotein | C | 62 | Salmonella Typhimurium Lt2 | CTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLIKADLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-09-20 Deposition Author(s): Acton, T.B. , Baran, M.C. , Fang, Y. , Hunt, J.F. , Kuzin, A.P. , Liu, J. , Mao, L.-C. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Owens, L. , Rost, B. , Seetharaman, J. , Su, M. , Tong, L. , Vorobiev, S.M. , Wang, D. , Xiao, R.