Crystal structure of rb human arg-insulin
PDB DOI: 10.2210/pdb2r35/pdb
Classification: HORMONE Organism(s): Salmonella Enterica
Deposited: 2007-08-29 Deposition Author(s): Pattabhi, V. , Rajan, S.S. , Sreekanth, R.
Crystal structure of rb human arg-insulin
Pattabhi, V. , Rajan, S.S. , Sreekanth, R.
Primary Citation of Related Structures: 2R35
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin | A | 22 | Salmonella Enterica | RGIVEQCCTSICSLYQLENYCN |
Insulin | C | 22 | Salmonella Enterica | RGIVEQCCTSICSLYQLENYCN |
Insulin | B | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Insulin | D | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-08-29 Deposition Author(s): Pattabhi, V. , Rajan, S.S. , Sreekanth, R.