Scr1 of daf from 1ojv fitted into cryoem density
PDB DOI: 10.2210/pdb2qzf/pdb
Classification: IMMUNE SYSTEM Organism(s): Salmonella Enterica
Deposited: 2007-08-16 Deposition Author(s): Bator Kelly, C.M. , Bowman, V.D. , Chipman, P.R. , Hafenstein, S. , Lin, F. , Medof, M.E. , Rossmann, M.G.
Scr1 of daf from 1ojv fitted into cryoem density
Bator Kelly, C.M. , Bowman, V.D. , Chipman, P.R. , Hafenstein, S. , Lin, F. , Medof, M.E. , Rossmann, M.G.
Primary Citation of Related Structures: 2QZF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Complement decay-accelerating factor | A | 62 | Salmonella Enterica | MQDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFC |
Method: ELECTRON MICROSCOPY
Deposited Date: 2007-08-16 Deposition Author(s): Bator Kelly, C.M. , Bowman, V.D. , Chipman, P.R. , Hafenstein, S. , Lin, F. , Medof, M.E. , Rossmann, M.G.