Fitted structure of scr4 of daf into cryoem density
PDB DOI: 10.2210/pdb2qzd/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2007-08-16 Deposition Author(s): Bator Kelly, C.M. , Bowman, V.D. , Chipman, P.R. , Hafenstein, S. , Lin, F. , Medof, M.E. , Rossmann, M.G.
Fitted structure of scr4 of daf into cryoem density
Bator Kelly, C.M. , Bowman, V.D. , Chipman, P.R. , Hafenstein, S. , Lin, F. , Medof, M.E. , Rossmann, M.G.
Primary Citation of Related Structures: 2QZD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Complement decay-accelerating factor | A | 65 | Homo Sapiens | EIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGC |
Method: ELECTRON MICROSCOPY
Deposited Date: 2007-08-16 Deposition Author(s): Bator Kelly, C.M. , Bowman, V.D. , Chipman, P.R. , Hafenstein, S. , Lin, F. , Medof, M.E. , Rossmann, M.G.