2QQS
Jmjd2a tandem tudor domains in complex with a trimethylated histone h4-k20 peptide
PDB DOI: 10.2210/pdb2qqs/pdb
Classification: OXIDOREDUCTASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-07-26 Deposition Author(s): Botuyan, M.V. , Lee, J. , Mer, G.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.82 Å
Jmjd2a tandem tudor domains in complex with a trimethylated histone h4-k20 peptide
Botuyan, M.V. , Lee, J. , Mer, G.
Primary Citation of Related Structures: 2QQS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| JmjC domain-containing histone demethylation protein 3A | A | 118 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP |
| JmjC domain-containing histone demethylation protein 3A | B | 118 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP |
| METHYLATED HISTONE H4 PEPTIDE | C | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KRHRKVLRDN |
| METHYLATED HISTONE H4 PEPTIDE | D | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KRHRKVLRDN |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2007-07-26 Deposition Author(s): Botuyan, M.V. , Lee, J. , Mer, G.