Crystal structure of a putative dna damage-inducible protein (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
PDB DOI: 10.2210/pdb2qnl/pdb
Classification: SIGNALING PROTEIN Organism(s): Cytophaga Hutchinsonii Atcc 33406
Deposited: 2007-07-18 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of a putative dna damage-inducible protein (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 2QNL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein | A | 162 | Cytophaga Hutchinsonii Atcc 33406 | GMHTQEALFVRLALDAWNTQSSRTDKLIQSLSNEALAVETAPGRNSGTYLLGHLTAVHDAMLPLLELGDTLYPQLAPVFIQNPDKSGLEKPEINDLRLYWSLVQERLANQFNQLQPADWFNKHAAISREDFLKEPHRNKLSVLINRTNHMAYHLGQLAYLKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-07-18 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)