Structure of human arg-insulin
PDB DOI: 10.2210/pdb2qiu/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2007-07-05 Deposition Author(s): Pattabhi, V. , Rajan, S.S. , Sreekanth, R.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Structure of human arg-insulin
Pattabhi, V. , Rajan, S.S. , Sreekanth, R.
Primary Citation of Related Structures: 2QIU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin | A | 22 | Homo Sapiens | RGIVEQCCTSICSLYQLENYCN |
| Insulin | C | 22 | Homo Sapiens | RGIVEQCCTSICSLYQLENYCN |
| Insulin | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Insulin | D | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-07-05 Deposition Author(s): Pattabhi, V. , Rajan, S.S. , Sreekanth, R.