2QIC
Crystal structure of the ing1 phd finger in complex with a histone h3k4me3 peptide
PDB DOI: 10.2210/pdb2qic/pdb
Classification: ANTITUMOR PROTEIN, APOPTOSIS Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-07-03 Deposition Author(s): Champagne, K. , Kutateladze, T.G. , Pena, P.V. , Zhao, R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of the ing1 phd finger in complex with a histone h3k4me3 peptide
Champagne, K. , Kutateladze, T.G. , Pena, P.V. , Zhao, R.
Primary Citation of Related Structures: 2QIC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Inhibitor of growth protein 1 | A | 62 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSDLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENE |
| H3K4ME3 PEPTIDE | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2007-07-03 Deposition Author(s): Champagne, K. , Kutateladze, T.G. , Pena, P.V. , Zhao, R.