Crystal structure of the ing1 phd finger in complex with a histone h3k4me3 peptide
PDB DOI: 10.2210/pdb2qic/pdb
Classification: ANTITUMOR PROTEIN, APOPTOSIS Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2007-07-03 Deposition Author(s): Champagne, K. , Kutateladze, T.G. , Pena, P.V. , Zhao, R.
Crystal structure of the ing1 phd finger in complex with a histone h3k4me3 peptide
Champagne, K. , Kutateladze, T.G. , Pena, P.V. , Zhao, R.
Primary Citation of Related Structures: 2QIC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Inhibitor of growth protein 1 | A | 62 | Homo Sapiens , Synthetic Construct | GSDLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENE |
H3K4ME3 PEPTIDE | B | 12 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTG |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-07-03 Deposition Author(s): Champagne, K. , Kutateladze, T.G. , Pena, P.V. , Zhao, R.