Crystal structure of ngtrf complexed with telomeric dna
PDB DOI: 10.2210/pdb2qhb/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Poecilia Reticulata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-07-02 Deposition Author(s): Byun, J.-S. , Cho, H.-S. , Jun, S.-H.
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Crystal structure of ngtrf complexed with telomeric dna
Byun, J.-S. , Cho, H.-S. , Jun, S.-H.
Primary Citation of Related Structures: 2QHB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Telomere binding protein TBP1 | A | 86 | Poecilia Reticulata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ |
Telomere binding protein TBP1 | B | 86 | Poecilia Reticulata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-07-02 Deposition Author(s): Byun, J.-S. , Cho, H.-S. , Jun, S.-H.