High resolution structure of the major periplasmic domain from the cell shape-determining filament mrec (monoclinic form)
PDB DOI: 10.2210/pdb2qf5/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Streptococcus Pneumoniae
Deposited: 2007-06-26 Deposition Author(s): Lovering, A.L. , Strynadka, N.C.J.
High resolution structure of the major periplasmic domain from the cell shape-determining filament mrec (monoclinic form)
Lovering, A.L. , Strynadka, N.C.J.
Primary Citation of Related Structures: 2QF5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cell shape determining protein MreC | A | 172 | Streptococcus Pneumoniae | SKLQATKTLAADVIMRSPVSWKQELTLDAGRSKGASENMLAIANGGLIGSVSKVEENSTIVNLLTNTENADKISVKIQHGSTTIYGIIIGYDKENDVLKISQLNSNSDISAGDKVTTGGLGNFNVADIPVGEVVATTHSTDYLTREVTVKLSADTHNVDVIELVGNSKLVPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-06-26 Deposition Author(s): Lovering, A.L. , Strynadka, N.C.J.