Crystal structure of the c890s mutant of the 4th pdz domain of human membrane associated guanylate kinase
PDB DOI: 10.2210/pdb2q9v/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica
Deposited: 2007-06-14 Deposition Author(s): Arrowsmith, C.A. , Cooper, C. , Doyle, D.A. , Edwards, A. , Elkins, J.M. , Hozjan, V. , Kavanagh, K.L. , Oppermann, U. , Papagrigoriou, E. , Pilka, E.S. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Von Delft, F. , Weigelt, J.
Crystal structure of the c890s mutant of the 4th pdz domain of human membrane associated guanylate kinase
Arrowsmith, C.A. , Cooper, C. , Doyle, D.A. , Edwards, A. , Elkins, J.M. , Hozjan, V. , Kavanagh, K.L. , Oppermann, U. , Papagrigoriou, E. , Pilka, E.S. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Von Delft, F. , Weigelt, J.
Primary Citation of Related Structures: 2Q9V
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | A | 90 | Salmonella Enterica | SMEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELISVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRQTRL |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-06-14 Deposition Author(s): Arrowsmith, C.A. , Cooper, C. , Doyle, D.A. , Edwards, A. , Elkins, J.M. , Hozjan, V. , Kavanagh, K.L. , Oppermann, U. , Papagrigoriou, E. , Pilka, E.S. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Von Delft, F. , Weigelt, J.