Nmr and x-ray analysis of structural additivity in metal binding site-swapped hybrids of rubredoxin
PDB DOI: 10.2210/pdb2pve/pdb
Classification: ELECTRON TRANSPORT Organism(s): Escherichia Coli (Strain Atcc 8739 / Dsm 1576 / Crooks)
Deposited: 2007-05-09 Deposition Author(s): Anderson, J.S. , Guo, Y. , Hernandez, G. , Lemaster, D.M. , Li, H. , Wang, L.
Nmr and x-ray analysis of structural additivity in metal binding site-swapped hybrids of rubredoxin
Anderson, J.S. , Guo, Y. , Hernandez, G. , Lemaster, D.M. , Li, H. , Wang, L.
Primary Citation of Related Structures: 2PVE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Rubredoxin | A | 54 | Escherichia Coli (Strain Atcc 8739 / Dsm 1576 / Crooks) | MKKYTCKICGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPICGAPKSEFEEVEE |
Rubredoxin | B | 54 | Escherichia Coli (Strain Atcc 8739 / Dsm 1576 / Crooks) | MKKYTCKICGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPICGAPKSEFEEVEE |
Rubredoxin | C | 54 | Escherichia Coli (Strain Atcc 8739 / Dsm 1576 / Crooks) | MKKYTCKICGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPICGAPKSEFEEVEE |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-05-09 Deposition Author(s): Anderson, J.S. , Guo, Y. , Hernandez, G. , Lemaster, D.M. , Li, H. , Wang, L.