Structure of the btb (tramtrack and bric a brac) domain of human gigaxonin
PDB DOI: 10.2210/pdb2ppi/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-04-30 Deposition Author(s): Amos, A. , Arrowsmith, C.H. , Bullock, A. , Burgess-Brown, N. , Debreczeni, J.E. , Edwards, A. , Keates, T. , Knapp, S. , Papagrigoriou, E. , Pike, A.C.W. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Tickle, J. , Turnbull, A.P. , Ugochukwu, E. , Umeano, C. , Von Delft, F. , Weigelt, J.
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Structure of the btb (tramtrack and bric a brac) domain of human gigaxonin
Amos, A. , Arrowsmith, C.H. , Bullock, A. , Burgess-Brown, N. , Debreczeni, J.E. , Edwards, A. , Keates, T. , Knapp, S. , Papagrigoriou, E. , Pike, A.C.W. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Tickle, J. , Turnbull, A.P. , Ugochukwu, E. , Umeano, C. , Von Delft, F. , Weigelt, J.
Primary Citation of Related Structures: 2PPI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gigaxonin | A | 144 | Homo Sapiens | MHHHHHHSSGVDLGTENLYFQSMAVSDPQHAARLLRALSSFREESRFCDAHLVLDGEEIPVQKNILAAASPYIRTKLNYNPPKDDGSTYKIELEGISVMVMREILDYIFSGQIRLNEDTIQDVVQAADLLLLTDLKTLCCEFLE |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-04-30 Deposition Author(s): Amos, A. , Arrowsmith, C.H. , Bullock, A. , Burgess-Brown, N. , Debreczeni, J.E. , Edwards, A. , Keates, T. , Knapp, S. , Papagrigoriou, E. , Pike, A.C.W. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Tickle, J. , Turnbull, A.P. , Ugochukwu, E. , Umeano, C. , Von Delft, F. , Weigelt, J.