Crystal structure analysis of hp1043, an orphan resonse regulator of h. pylori
PDB DOI: 10.2210/pdb2pln/pdb
Classification: SIGNALING PROTEIN Organism(s): Helicobacter Pylori
Deposited: 2007-04-20 Deposition Author(s): Byun, J.S. , Cho, H.S. , Kim, D.U. , Lee, H.M.
Crystal structure analysis of hp1043, an orphan resonse regulator of h. pylori
Byun, J.S. , Cho, H.S. , Kim, D.U. , Lee, H.M.
Primary Citation of Related Structures: 2PLN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Response regulator | A | 137 | Helicobacter Pylori | MRGSHHHHHHGSLVPRGSMRVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLVMVSDKNALSFVSRIKEKHSSIVVLVSSDNPTSEEEVHAFEQGADDYIAKPYRSIKALVARIEARLRFWGSN |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-04-20 Deposition Author(s): Byun, J.S. , Cho, H.S. , Kim, D.U. , Lee, H.M.