Solution structure of rhodostomin d51e mutant
PDB DOI: 10.2210/pdb2pjg/pdb
Classification: HYDROLASE Organism(s): Calloselasma Rhodostoma
Deposited: 2007-04-16 Deposition Author(s): Chen, C.Y. , Chen, Y.C. , Chou, L.J. , Chuang, W.J.
Solution structure of rhodostomin d51e mutant
Chen, C.Y. , Chen, Y.C. , Chou, L.J. , Chuang, W.J.
Primary Citation of Related Structures: 2PJG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rhodostoxin-disintegrin rhodostomin | A | 68 | Calloselasma Rhodostoma | GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRGEMPDDRCTGQSADCPRYH |
Method: SOLUTION NMR
Deposited Date: 2007-04-16 Deposition Author(s): Chen, C.Y. , Chen, Y.C. , Chou, L.J. , Chuang, W.J.