Solution structure of rhodostomin
PDB DOI: 10.2210/pdb2pjf/pdb
Classification: HYDROLASE Organism(s): Calloselasma Rhodostoma
Deposited: 2007-04-16 Deposition Author(s): Chang, Y.T. , Chen, C.Y. , Chen, Y.C. , Chuang, W.J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of rhodostomin
Chang, Y.T. , Chen, C.Y. , Chen, Y.C. , Chuang, W.J.
Primary Citation of Related Structures: 2PJF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rhodostoxin-disintegrin rhodostomin | A | 68 | Calloselasma Rhodostoma | GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRGDMPDDRCTGQSADCPRYH |
Method: SOLUTION NMR
Deposited Date: 2007-04-16 Deposition Author(s): Chang, Y.T. , Chen, C.Y. , Chen, Y.C. , Chuang, W.J.