Structure of a h51n mutant dtdp-4-keto-6-deoxy-d-glucose-3,4-ketoisomerase from aneurinibacillus thermoaerophilus complexed with tdp
PDB DOI: 10.2210/pdb2pak/pdb
Classification: ISOMERASE Organism(s): Aneurinibacillus Thermoaerophilus
Deposited: 2007-03-27 Deposition Author(s): Davis, M.L. , Holden, H.M. , Thoden, J.B.
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Structure of a h51n mutant dtdp-4-keto-6-deoxy-d-glucose-3,4-ketoisomerase from aneurinibacillus thermoaerophilus complexed with tdp
Davis, M.L. , Holden, H.M. , Thoden, J.B.
Primary Citation of Related Structures: 2PAK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DTDP-6-deoxy-3,4-keto-hexulose isomerase | A | 141 | Aneurinibacillus Thermoaerophilus | GHMENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFHANKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKYIAKINLEKEG |
| DTDP-6-deoxy-3,4-keto-hexulose isomerase | B | 141 | Aneurinibacillus Thermoaerophilus | GHMENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFHANKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKYIAKINLEKEG |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-03-27 Deposition Author(s): Davis, M.L. , Holden, H.M. , Thoden, J.B.