Full-sequence computational design and solution structure of a thermostable protein variant
PDB DOI: 10.2210/pdb2p6j/pdb
Classification: DE NOVO PROTEIN Organism(s): Unidentified
Deposited: 2007-03-18 Deposition Author(s): Crowhurst, K.A. , Hom, G.K. , Lassila, J.K. , Mayo, S.L. , Ross, S.A. , Shah, P.S.
Method: SOLUTION NMR Resolution: N.A.
Full-sequence computational design and solution structure of a thermostable protein variant
Crowhurst, K.A. , Hom, G.K. , Lassila, J.K. , Mayo, S.L. , Ross, S.A. , Shah, P.S.
Primary Citation of Related Structures: 2P6J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| designed engrailed homeodomain variant UVF | A | 52 | Unidentified | MKQWSENVEEKLKEFVKRHQRITQEELHQYAQRLGLNEEAIRQFFEEFEQRK |
Method: SOLUTION NMR
Deposited Date: 2007-03-18 Deposition Author(s): Crowhurst, K.A. , Hom, G.K. , Lassila, J.K. , Mayo, S.L. , Ross, S.A. , Shah, P.S.