Gap domain of znf289, an id1-regulated zinc finger protein
PDB DOI: 10.2210/pdb2p57/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-03-14 Deposition Author(s): Arrowsmith, C.H. , Bochkarev, A. , Dimov, S. , Edwards, A.M. , Landry, R. , Park, H. , Shen, L. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Tempel, W. , Tong, Y. , Weigelt, J. , Zhu, H.
Gap domain of znf289, an id1-regulated zinc finger protein
Arrowsmith, C.H. , Bochkarev, A. , Dimov, S. , Edwards, A.M. , Landry, R. , Park, H. , Shen, L. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Tempel, W. , Tong, Y. , Weigelt, J. , Zhu, H.
Primary Citation of Related Structures: 2P57
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| GTPase-activating protein ZNF289 | A | 144 | Homo Sapiens | MHHHHHHSSGLVPRGSAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALARHG |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-03-14 Deposition Author(s): Arrowsmith, C.H. , Bochkarev, A. , Dimov, S. , Edwards, A.M. , Landry, R. , Park, H. , Shen, L. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Tempel, W. , Tong, Y. , Weigelt, J. , Zhu, H.