Structure of the q67h mutant of r67 dihydrofolate reductase-nadp+ complex reveals a novel cofactor binding mode
PDB DOI: 10.2210/pdb2p4t/pdb
Classification: OXIDOREDUCTASE Organism(s): Escherichia Coli
Deposited: 2007-03-13 Deposition Author(s): Divya, N. , Grifith, E. , Narayana, N.
Structure of the q67h mutant of r67 dihydrofolate reductase-nadp+ complex reveals a novel cofactor binding mode
Divya, N. , Grifith, E. , Narayana, N.
Primary Citation of Related Structures: 2P4T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dihydrofolate reductase type 2 | A | 62 | Escherichia Coli | VFPSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVHIYPVAALERIN |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-03-13 Deposition Author(s): Divya, N. , Grifith, E. , Narayana, N.