Structure and sodium channel activity of an excitatory i1-superfamily conotoxin
PDB DOI: 10.2210/pdb2p4l/pdb
Classification: TOXIN Organism(s): Conus Radiatus
Deposited: 2007-03-12 Deposition Author(s): Babon, J.J. , Buczek, O. , Bulaj, G. , Fiedler, B. , Norton, R.S. , Olivera, B.M. , Wei, D.X. , Yang, X.D. , Yoshikami, D.
Method: SOLUTION NMR Resolution: N.A.
Structure and sodium channel activity of an excitatory i1-superfamily conotoxin
Babon, J.J. , Buczek, O. , Bulaj, G. , Fiedler, B. , Norton, R.S. , Olivera, B.M. , Wei, D.X. , Yang, X.D. , Yoshikami, D.
Primary Citation of Related Structures: 2P4L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| I-superfamily conotoxin r11a | A | 46 | Conus Radiatus | GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGCSTSSFFKI |
Method: SOLUTION NMR
Deposited Date: 2007-03-12 Deposition Author(s): Babon, J.J. , Buczek, O. , Bulaj, G. , Fiedler, B. , Norton, R.S. , Olivera, B.M. , Wei, D.X. , Yang, X.D. , Yoshikami, D.