Crystal structure of the multi-drug resistant mutant subtype f hiv protease complexed with tl-3 inhibitor
PDB DOI: 10.2210/pdb2p3d/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Human Immunodeficiency Virus 1
Deposited: 2007-03-08 Deposition Author(s): Gustchina, A. , Krauchenco, S. , Martins, N.H. , Polikarpov, I. , Sanches, M. , Wlodawer, A.
Crystal structure of the multi-drug resistant mutant subtype f hiv protease complexed with tl-3 inhibitor
Gustchina, A. , Krauchenco, S. , Martins, N.H. , Polikarpov, I. , Sanches, M. , Wlodawer, A.
Primary Citation of Related Structures: 2P3D
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pol protein | A | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPIVTIKVEGQLREALLDTGADDTVLEDINLSGKWKPKIIGGIRGFVKVKQYEDILIEICGHRAVGAVLVGPTPANIIGRNMLTQIGCTLNF |
| Pol protein | B | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPIVTIKVEGQLREALLDTGADDTVLEDINLSGKWKPKIIGGIRGFVKVKQYEDILIEICGHRAVGAVLVGPTPANIIGRNMLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-03-08 Deposition Author(s): Gustchina, A. , Krauchenco, S. , Martins, N.H. , Polikarpov, I. , Sanches, M. , Wlodawer, A.