Structural insights into the evolution of a non-biological protein
PDB DOI: 10.2210/pdb2p09/pdb
Classification: DE NOVO PROTEIN Organism(s): Lactococcus Lactis Subsp. Cremoris
Deposited: 2007-02-28 Deposition Author(s): Allen, J.P. , Chaput, J.C. , Rosenow, M. , Smith, M. , Szostak, J.W. , Wang, M.
Method: X-RAY DIFFRACTION Resolution: 1.65 Å
Structural insights into the evolution of a non-biological protein
Allen, J.P. , Chaput, J.C. , Rosenow, M. , Smith, M. , Szostak, J.W. , Wang, M.
Primary Citation of Related Structures: 2P09
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
a non-biological ATP binding protein with two mutations N32D and D65V | A | 81 | Lactococcus Lactis Subsp. Cremoris | GSMDYKDDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADSKEISNT |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-02-28 Deposition Author(s): Allen, J.P. , Chaput, J.C. , Rosenow, M. , Smith, M. , Szostak, J.W. , Wang, M.