Crystal structure of bordetella pertussis holo ferric binding protein with bound synergistic carbonate anion
PDB DOI: 10.2210/pdb2owt/pdb
Classification: METAL BINDING PROTEIN Organism(s): Bordetella Pertussis Tohama I
Deposited: 2007-02-16 Deposition Author(s): Murphy, M.E.P. , Tom-Yew, S.A.L.
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Crystal structure of bordetella pertussis holo ferric binding protein with bound synergistic carbonate anion
Murphy, M.E.P. , Tom-Yew, S.A.L.
Primary Citation of Related Structures: 2OWT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative iron binding protein | A | 323 | Bordetella Pertussis Tohama I | GSHMSDEVSLYTTREPKLIQPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQKIQSQTLDSVVPANLRGAEGSWYALSLRDRVLYVEKDLKLDSFRYGDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLANAYYVGHMKNAEPGTDARKWGDAIKVVRPTFATAKDGGTHVNISGAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQANYEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASELVDKVGFDN |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-02-16 Deposition Author(s): Murphy, M.E.P. , Tom-Yew, S.A.L.