Crystal structure of a vinyl-4-reductase family protein (mj_1460) from methanocaldococcus jannaschii dsm at 2.40 a resolution
PDB DOI: 10.2210/pdb2osd/pdb
Classification: METAL BINDING PROTEIN Organism(s): Methanocaldococcus Jannaschii Dsm 2661
Deposited: 2007-02-05 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of a vinyl-4-reductase family protein (mj_1460) from methanocaldococcus jannaschii dsm at 2.40 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 2OSD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hypothetical protein MJ1460 | A | 163 | Methanocaldococcus Jannaschii Dsm 2661 | GMAFMEKIFPDILEAIRNEEIIKESKKIPMPYFGLFALVIFDKVKELGSETSLYEIGEEFGKMLSPKNIEELKKIFKLMNFGDLEIDENKILLKNPPYKIKLSNPPYQWVSKEEPIHDFIAGILAGCLEEIFYYYFVVNEVECVSQGKDKCVFEVKEVDELNK |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-02-05 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)