Crystal structure of mif bound to a novel inhibitor, oxim-11
PDB DOI: 10.2210/pdb2ooh/pdb
Classification: ISOMERASE Organism(s): Homo Sapiens
Deposited: 2007-01-25 Deposition Author(s): Al-Abed, Y. , Crichlow, G.V. , Lolis, E.
Crystal structure of mif bound to a novel inhibitor, oxim-11
Al-Abed, Y. , Crichlow, G.V. , Lolis, E.
Primary Citation of Related Structures: 2OOH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Macrophage migration inhibitory factor | A | 114 | Homo Sapiens | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Macrophage migration inhibitory factor | B | 114 | Homo Sapiens | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Macrophage migration inhibitory factor | C | 114 | Homo Sapiens | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-01-25 Deposition Author(s): Al-Abed, Y. , Crichlow, G.V. , Lolis, E.