Crystal structure of the uba domain from human c-cbl ubiquitin ligase
PDB DOI: 10.2210/pdb2oo9/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2007-01-25 Deposition Author(s): Gehring, K. , Kozlov, G.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of the uba domain from human c-cbl ubiquitin ligase
Primary Citation of Related Structures: 2OO9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase CBL | A | 46 | Homo Sapiens | GSQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFAAAS |
| E3 ubiquitin-protein ligase CBL | B | 46 | Homo Sapiens | GSQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFAAAS |
| E3 ubiquitin-protein ligase CBL | C | 46 | Homo Sapiens | GSQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFAAAS |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-01-25 Deposition Author(s): Gehring, K. , Kozlov, G.