2OI3
Nmr structure analysis of the hematopoetic cell kinase sh3 domain complexed with an artificial high affinity ligand (pd1)
PDB DOI: 10.2210/pdb2oi3/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-01-10 Deposition Author(s): Hoffmann, S. , Schmidt, H. , Stoldt, M. , Tran, T. , Willbold, D.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure analysis of the hematopoetic cell kinase sh3 domain complexed with an artificial high affinity ligand (pd1)
Hoffmann, S. , Schmidt, H. , Stoldt, M. , Tran, T. , Willbold, D.
Primary Citation of Related Structures: 2OI3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase HCK | A | 86 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLET |
| artificial peptide PD1 | B | 14 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XHSKYPLPPLPSLX |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-01-10 Deposition Author(s): Hoffmann, S. , Schmidt, H. , Stoldt, M. , Tran, T. , Willbold, D.