Crystal structure of the lambda xis-dna complex
PDB DOI: 10.2210/pdb2og0/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Enterobacteria Phage Lambda , Synthetic Construct
Deposited: 2007-01-04 Deposition Author(s): Abbani, M.A. , Cascio, D. , Clubb, R.T. , Johnson, R.C. , Papagiannis, C.V. , Sam, M.D. , Yoo, D.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of the lambda xis-dna complex
Abbani, M.A. , Cascio, D. , Clubb, R.T. , Johnson, R.C. , Papagiannis, C.V. , Sam, M.D. , Yoo, D.
Primary Citation of Related Structures: 2OG0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Excisionase | A | 52 | Enterobacteria Phage Lambda , Synthetic Construct | MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKVDL |
| Excisionase | B | 52 | Enterobacteria Phage Lambda , Synthetic Construct | MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKVDL |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-01-04 Deposition Author(s): Abbani, M.A. , Cascio, D. , Clubb, R.T. , Johnson, R.C. , Papagiannis, C.V. , Sam, M.D. , Yoo, D.