Amber refined nmr structure of the sigma-54 rpon domain bound to the-24 promoter element
PDB DOI: 10.2210/pdb2o9l/pdb
Classification: RNA POLYMERASE SIGMA FACTOR RPON/DNA Organism(s): Aquifex Aeolicus , Synthetic Construct
Deposited: 2006-12-13 Deposition Author(s): Doucleff, M. , Lee, P.S. , Pelton, J.G. , Wemmer, D.E.
Amber refined nmr structure of the sigma-54 rpon domain bound to the-24 promoter element
Doucleff, M. , Lee, P.S. , Pelton, J.G. , Wemmer, D.E.
Primary Citation of Related Structures: 2O9L
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA polymerase sigma factor RpoN | A | 63 | Aquifex Aeolicus , Synthetic Construct | HMLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREMLGIPSSRERRI |
Method: SOLUTION NMR
Deposited Date: 2006-12-13 Deposition Author(s): Doucleff, M. , Lee, P.S. , Pelton, J.G. , Wemmer, D.E.