Nmr structure of the sigma-54 rpon domain bound to the-24 promoter element
PDB DOI: 10.2210/pdb2o8k/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Aquifex Aeolicus , Synthetic Construct
Deposited: 2006-12-12 Deposition Author(s): Doucleff, M. , Lee, P.S. , Pelton, J.G. , Wemmer, D.E.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the sigma-54 rpon domain bound to the-24 promoter element
Doucleff, M. , Lee, P.S. , Pelton, J.G. , Wemmer, D.E.
Primary Citation of Related Structures: 2O8K
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA polymerase sigma factor RpoN | A | 63 | Aquifex Aeolicus , Synthetic Construct | HMLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREMLGIPSSRERRI |
Method: SOLUTION NMR
Deposited Date: 2006-12-12 Deposition Author(s): Doucleff, M. , Lee, P.S. , Pelton, J.G. , Wemmer, D.E.