Solution structure of the anti-apoptotic protein bcl-xl in complex with an acyl-sulfonamide-based ligand
PDB DOI: 10.2210/pdb2o2m/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2006-11-30 Deposition Author(s): Belli, B.A. , Bruncko, M. , Ding, H. , Elmore, S.W. , Fesik, S.W. , Joseph, M.K. , Kunzer, A. , Martineau, D. , Mcclellan, W.J. , Mitten, M. , Ng, S.C. , Nimmer, P.M. , Oltersdorf, T. , Oost, T.K. , Park, C.M. , Petros, A.M. , Rosenberg, S.H. , Shoemaker, A.R. , Song, X. , Wang, X. , Wendt, M.D. , Zhang, H.
Solution structure of the anti-apoptotic protein bcl-xl in complex with an acyl-sulfonamide-based ligand
Belli, B.A. , Bruncko, M. , Ding, H. , Elmore, S.W. , Fesik, S.W. , Joseph, M.K. , Kunzer, A. , Martineau, D. , Mcclellan, W.J. , Mitten, M. , Ng, S.C. , Nimmer, P.M. , Oltersdorf, T. , Oost, T.K. , Park, C.M. , Petros, A.M. , Rosenberg, S.H. , Shoemaker, A.R. , Song, X. , Wang, X. , Wendt, M.D. , Zhang, H.
Primary Citation of Related Structures: 2O2M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Apoptosis regulator Bcl-X | A | 145 | Homo Sapiens | SQSNRELVVDFLSYKLSQKGYSAGGGGGGGGMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG |
Method: SOLUTION NMR
Deposited Date: 2006-11-30 Deposition Author(s): Belli, B.A. , Bruncko, M. , Ding, H. , Elmore, S.W. , Fesik, S.W. , Joseph, M.K. , Kunzer, A. , Martineau, D. , Mcclellan, W.J. , Mitten, M. , Ng, S.C. , Nimmer, P.M. , Oltersdorf, T. , Oost, T.K. , Park, C.M. , Petros, A.M. , Rosenberg, S.H. , Shoemaker, A.R. , Song, X. , Wang, X. , Wendt, M.D. , Zhang, H.